Protein Info for ABZR86_RS11810 in Dyella japonica UNC79MFTsu3.2

Annotation: pilus assembly protein PilM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR01175: type IV pilus assembly protein PilM" amino acids 9 to 351 (343 residues), 449.1 bits, see alignment E=5e-139 PF11104: PilM_2" amino acids 13 to 351 (339 residues), 454.1 bits, see alignment E=2.8e-140 PF14450: FtsA" amino acids 194 to 319 (126 residues), 39.5 bits, see alignment E=7.1e-14

Best Hits

KEGG orthology group: K02662, type IV pilus assembly protein PilM (inferred from 75% identity to xal:XALc_2353)

Predicted SEED Role

"Type IV pilus biogenesis protein PilM" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2GZ16 at UniProt or InterPro

Protein Sequence (352 amino acids)

>ABZR86_RS11810 pilus assembly protein PilM (Dyella japonica UNC79MFTsu3.2)
MGLFTPKKPPLIGVDISSTAVKLLQLSQAGGRYRVEHYAVEPLPPNAVVEKNIVEVEAVG
EAIRRAVARSGTKLKHAAAAVAGSAVITRIIPMSSDLSEEDLEGQIQVEANQYIPYPIEE
VSLDFEVLGPVRDNPEMNNVLLAASRTENVDMRVAALDLGGIGAKVVDVEAFAMENAFSM
VADQLNVGRDALVAVVDIGATMTTLSVLRNQRTIYSREQVFGGKQLTDEIMRRYGLSYEE
AGRAKRKGGLPESYETEALEPFKESLIQQISRLLQFFFAGSEFSKVDQVVLAGGCASIEG
LCPMLEEQLGVSCVVANPLARMSLSPRVQAQQLAQDAPALMIAVGLAMRSFD