Protein Info for ABZR86_RS11790 in Dyella japonica UNC79MFTsu3.2

Annotation: type IV pilus secretin PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 730 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF11741: AMIN" amino acids 47 to 126 (80 residues), 27.4 bits, see alignment E=5.8e-10 amino acids 159 to 262 (104 residues), 75.7 bits, see alignment E=5.4e-25 TIGR02515: type IV pilus secretin PilQ" amino acids 281 to 725 (445 residues), 525.6 bits, see alignment E=5.1e-162 PF07660: STN" amino acids 308 to 354 (47 residues), 35.9 bits, see alignment 1e-12 PF03958: Secretin_N" amino acids 381 to 457 (77 residues), 55.9 bits, see alignment E=7.9e-19 PF00263: Secretin" amino acids 561 to 725 (165 residues), 176.7 bits, see alignment E=6e-56

Best Hits

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2H192 at UniProt or InterPro

Protein Sequence (730 amino acids)

>ABZR86_RS11790 type IV pilus secretin PilQ (Dyella japonica UNC79MFTsu3.2)
MRHASRRLFTALLIAGAAWSGLAAAATNTLREISYDTLPGGKVELHLNFAQGPVPEPKVF
TTGNPPRIAIDFPDTENSAARHLDIGKGSTMGVSAISAGGRTRVVVELMRDSSYRSRVDG
NSLVFTVSNGTEAQTTTTASIIDPSKALPSSAAGPAVSNIDFRRGPNGEGRVLINFSGSG
ANADMKREGDKVVVNLDHVNLPANLAQRLDVLDFATPVQSVTTKAGTRGGARMEIAVKGN
VETSAYQTGDQYVVEVAPKKVAPGTGPDGKPLKGQDPTYNGNRVTFNFQDIPVRSVLQLI
ADMSGQNLVAADTVGGAITLRLVNVPWDQALDVVLRAKGLDKRRNGNVIWIAPQEELAKY
EQSVAEARIKAEDTAELVTDYIPISYGKAQDIAKLLTQGSMGSTSGGGAGNASRGFLSSR
GSVSFDERTNTLLVNDNPQKIRELRDLIAVLDRPVQQVLIESRIVVATDTFTRELGVKWG
VQATHTTSGGNVISTSPTGTNAGGLAINQGNINNAGGTGTTTYQTGAGGFNVNLPATNAL
ASTLGLAILGKNYLVDLELSAAQSEGRGEVISSPRVITANQQEAVIRQGQEIGYVTYQNS
GGSGTAPTASVQFKDAVLELKVTPTITADNRVYLAINVKKDALAQFVTTPNGQVPQIDTR
EINTSVLVDNGQTVVLGGIYEITKQNTVTKVPGLGDIPGIGVLFRTTKRQNDKAELLIFV
TPRILSDSLR