Protein Info for ABZR86_RS11765 in Dyella japonica UNC79MFTsu3.2

Annotation: VWA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 60 to 81 (22 residues), see Phobius details amino acids 310 to 335 (26 residues), see Phobius details PF13519: VWA_2" amino acids 99 to 202 (104 residues), 41.1 bits, see alignment E=6e-14 PF00092: VWA" amino acids 135 to 228 (94 residues), 29.6 bits, see alignment E=1.9e-10 PF13432: TPR_16" amino acids 382 to 436 (55 residues), 33.4 bits, see alignment 1.4e-11 PF00515: TPR_1" amino acids 404 to 435 (32 residues), 34.1 bits, see alignment (E = 4.1e-12) PF07719: TPR_2" amino acids 404 to 437 (34 residues), 32.1 bits, see alignment (E = 1.9e-11)

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 38% identity to gag:Glaag_2674)

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2H217 at UniProt or InterPro

Protein Sequence (629 amino acids)

>ABZR86_RS11765 VWA domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MAWWHDFHFLRPWWLLGLLLAPLAYALAARGGQERRELARLVDPELLPHVLHGQGGDRRW
PPALLALGAALCALALAGPTWDRVASPLYASRAAQVVAVSLSRHMLAKDMAPSRIDRARY
KAHDLLAANRGGLNGLIAYAGEAFTVAPLTSDANALDDLLDALSPDTMPTDGNDAAAAIE
RATALIRDAKAGGGQLVLIADGADAAAQAAARKARGEGVRVSVLGIGTPQGSPVPDGDGG
LLRDAHGEVVVARRDDAALRALADAGGGRYVPMRDDGQDIAALKPGEGATQSFVQADGQH
GDEWQDRGPWLLLPLLAVFALAFRRGWLLLLPLVVLPALPSTAHAGSWSDLWRRPDQQAA
AALRQGDAKRAQELARDPSLRGAAAYRAGDFPEAATAWQGAQGADAAYNLGNALARQERY
KEAIEAYDRALRENPAHEDAKANRQAVEDWLRKHPPPQDQHKNQDKQDKHGDGKGGSDKD
QPGKGDDRPDDKKDGEPKPGQDQSKEGGGTDSKRDSSGQGKQDGQSAEKQGQGEAKPPSA
QEQAEQKARAEQARKALSAQMDQALRDGKQGKDDGAHELGAIPADDPQAKLPADVRRALQ
RVPDDPGALLRRKFELEYRQRHGSAGEDD