Protein Info for ABZR86_RS11740 in Dyella japonica UNC79MFTsu3.2

Annotation: M20/M25/M40 family metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04389: Peptidase_M28" amino acids 265 to 454 (190 residues), 102 bits, see alignment E=3.7e-33 PF01546: Peptidase_M20" amino acids 292 to 455 (164 residues), 32.7 bits, see alignment E=7.4e-12

Best Hits

KEGG orthology group: None (inferred from 58% identity to smt:Smal_3197)

Predicted SEED Role

"Aminopeptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2H4G9 at UniProt or InterPro

Protein Sequence (480 amino acids)

>ABZR86_RS11740 M20/M25/M40 family metallo-hydrolase (Dyella japonica UNC79MFTsu3.2)
MRRLPLTLLAASLALAAGASSAADKATTIPQSAVKTAEQLRDKAMGDDTGYKIVESLTTE
VGPRIAGGPNDQRGRDWAVAKFKELGYDKVYTETVTYPLWERRSEHAAIVGPFPQPLAVI
ALGYSAGTPKGGLTAEVVKFDSLDALKKADPASVKGKIVFVNAKMARHRDGHDYGIGSAV
RTGGPVLASKMGAAAFLLRSAGTDEHSRTPHTGVTGFRDPKEAIPAAALSLPDADQLDRV
LGYGKPVSIKLDLDCGITGTYTGANVIGEITGKKYPDQIVPIGGHLDSWDPGTGAIDDGA
GVAIAMAAGKMILSLPQRPDRTIRVIAFANEEMGLFGGRAYADKHASEVSKHQLGTESDF
GARKIWRMTASVKPSARGAIEQIAKVIEPVGVAYDPQHPGGGGSDLSQMHAKGMAALTLT
QDGTDYFDYHHTANDTLDKIDPRELAQNVAVYAAFSYMAAQADGDFGSAPDAFKNDGARD