Protein Info for ABZR86_RS11720 in Dyella japonica UNC79MFTsu3.2

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 24 to 172 (149 residues), 122.9 bits, E=8.1e-40

Best Hits

Swiss-Prot: 48% identical to LOLD_GEOMG: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)

KEGG orthology group: K02003, (no description) (inferred from 81% identity to psu:Psesu_2632)

MetaCyc: 44% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Sequence Analysis Tools

See A0A1I2H4F9 at UniProt or InterPro

Protein Sequence (228 amino acids)

>ABZR86_RS11720 ABC transporter ATP-binding protein (Dyella japonica UNC79MFTsu3.2)
MGTLIEVRDLSKVYERGKQKVEVLHHINLNIAEGDFLALMGPSGSGKTTLLNLIGGLDSP
TGGSIGVGGQRIDQLGAGALAKWRAANVGFVFQFYNLMPMLTAQRNVELPLLLTKLSAAQ
RRKNAAIALQLVGLDERSSHKPSELSGGQQQRVAIARAIVSDPTLLVCDEPTGDLDRQSA
EDVLGLLRTLNREHGKTIVMVTHDPKAAEYANHTLHLDKGTLVEQALA