Protein Info for ABZR86_RS11700 in Dyella japonica UNC79MFTsu3.2

Annotation: thioredoxin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00578: AhpC-TSA" amino acids 27 to 144 (118 residues), 42.5 bits, see alignment E=1.2e-14 PF08534: Redoxin" amino acids 41 to 152 (112 residues), 47.5 bits, see alignment E=3.4e-16 PF13905: Thioredoxin_8" amino acids 49 to 143 (95 residues), 37.1 bits, see alignment E=6.7e-13 PF17991: Thioredoxin_10" amino acids 186 to 316 (131 residues), 106.6 bits, see alignment E=3.3e-34

Best Hits

Predicted SEED Role

"DipZ protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2H123 at UniProt or InterPro

Protein Sequence (316 amino acids)

>ABZR86_RS11700 thioredoxin family protein (Dyella japonica UNC79MFTsu3.2)
MKKLLLSAGLLLGFLSGSIAASTPTQVPEFAGIDHWFNSPPLSMSGLRGKVVLIDFWAYS
CINCIRAMPHVQHLYETYKDQGLVVIGVHSPEFDFEHDPANVQEAIGRSGVTYPVAMDSR
LATWNAWHNQYWPAEYLVDRDGRLIGHHYGEGGYDKMENAIRLLLGLDMQAPGNAAGVFK
PGMGDTPELHLGSTGRQGFGNAESASDGTRRFSLPAQLPLHQFALAGQWEITRQYARSVG
GELELQLRFKAAKLYLVASAEHAMPLEVTVDGQPQATVTVQGSRLYTLFDSSDDREHLLR
LRIPQAGLRVYSFTFG