Protein Info for ABZR86_RS11675 in Dyella japonica UNC79MFTsu3.2

Annotation: drug/metabolite exporter YedA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details PF00892: EamA" amino acids 26 to 154 (129 residues), 69.1 bits, see alignment E=2.2e-23 amino acids 164 to 298 (135 residues), 73.8 bits, see alignment E=8e-25

Best Hits

Swiss-Prot: 50% identical to YEDA_ECOLI: Uncharacterized inner membrane transporter YedA (yedA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 54% identity to pap:PSPA7_5505)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HG54 at UniProt or InterPro

Protein Sequence (306 amino acids)

>ABZR86_RS11675 drug/metabolite exporter YedA (Dyella japonica UNC79MFTsu3.2)
MTDQSVSNAARAAQGPFTDTRVMIPLALFALYIIWGSTYLGIRYALGSYPPFLLAGIRFL
FAGVLLFGFLRLRGVAMPSTRQWRNAAVTGVLLLGFGNGLVCFAEQSVSSGIAAVAVASM
PLFAALFSGMYGQWPSGREALGLVIGFAGVVVLNLGSSLSASRIGAIALIVAAASWAFGS
IWSKRQDMPAGPMNTAAQMLCASVALLLVGFGTGERLPAHPTLHATLAVGYLVLFGSLIA
FSAYLYVLKHARPAVATSYAYVNPPVAVLFGVLLAGEHVGPYDIAGMAVILLGVAIITLF
KQRAKG