Protein Info for ABZR86_RS11655 in Dyella japonica UNC79MFTsu3.2

Annotation: SLC13 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 414 to 431 (18 residues), see Phobius details amino acids 437 to 454 (18 residues), see Phobius details amino acids 466 to 488 (23 residues), see Phobius details amino acids 502 to 539 (38 residues), see Phobius details amino acids 545 to 566 (22 residues), see Phobius details amino acids 582 to 604 (23 residues), see Phobius details PF03600: CitMHS" amino acids 13 to 551 (539 residues), 237.3 bits, see alignment E=4e-74 amino acids 503 to 605 (103 residues), 38.1 bits, see alignment E=1.6e-13 PF02080: TrkA_C" amino acids 236 to 303 (68 residues), 38.6 bits, see alignment E=1.2e-13 amino acids 327 to 390 (64 residues), 35.3 bits, see alignment E=1.2e-12 PF00939: Na_sulph_symp" amino acids 432 to 602 (171 residues), 49.8 bits, see alignment E=4.3e-17

Best Hits

KEGG orthology group: None (inferred from 53% identity to psu:Psesu_0482)

Predicted SEED Role

"sulfur deprivation response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HES4 at UniProt or InterPro

Protein Sequence (605 amino acids)

>ABZR86_RS11655 SLC13 family permease (Dyella japonica UNC79MFTsu3.2)
MILVLGLVGFTMLMLVLEWIRADMVALLVVVVIGLTGLIPSDRVFNGFAGNAVIAIIAIM
IMGAGLDRAGVLGLTANFVMRMARGVESRLGVVINLVTSLFSAVIPSQALAALMIPVTSR
LAARTGVPLSRLLLPMAFCILTATNTTLIANSPLIVLNDLIASANANLPPGAHTIPKFGL
FSVTPIGLALALFGVLFFYLFTSRLLPEREDERLKVTPGRTESYFADTYGIGGETAELTV
TAESPLVGMSIGEVEQLYGAPLILAIKSGTEARMAPPVDHVIWVGSVLGVLGPREQLGQF
ANNQLCKLSPRMRQLGELFNPSRAGISEAVIPPSSRFIKQTVGELRLRKRHGISVLAVNR
GDQVFRDDVRAVSLRAGDTLVLHSSWRDLALASEDKDLVVVTDIPKEEQRPGKIWQAVGF
FVLAKCLALFTHLDLSVAMMTGAIGMLLTGVLNMDEAYKAINWKTIFVTACLIPLGWSMD
ATGTAAWLAQEVLQHLGNASPYVLQLSLAILTLLFSQVMSNVGATVMMVPIAISVAVATG
GNPSAYALIVAVSSSNTFLLSSGHPALMMVAGPGGYRGKDFLRVGLPLTAMVLLITLVAI
NLMFR