Protein Info for ABZR86_RS11645 in Dyella japonica UNC79MFTsu3.2

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05690: ThiG
  • amino acids 14 to 260 (247 residues), 375.8 bits, E=4.6e-117

Best Hits

Swiss-Prot: 84% identical to THIG_XANOR: Thiazole synthase (thiG) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 84% identity to xoo:XOO3372)

MetaCyc: 58% identical to thiazole synthase (Bacillus subtilis subtilis 168)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Sequence Analysis Tools

See A0A1I2HGQ6 at UniProt or InterPro

Protein Sequence (266 amino acids)

>ABZR86_RS11645 thiazole synthase (Dyella japonica UNC79MFTsu3.2)
MNTKTHDVADPLIIAGKSYGSRLLTGTGKYKDFDETRRASQAAGAEIVTVAIRRVNIGQD
ASQPSLLDALPPDEFTLLPNTAGCYNAVDAVRTCKLARELLDGHKLVKLEVLGDERTLFP
DVVETLKAAETLVADGFDVMVYTSDDPILARRLEQIGCVAVMPLAAPIGSGLGIQNRYNL
LEIIEQAKVPIIVDAGVGTASDAAIAMELGCDGVLMNTAIAGARDPVLMAHAMKLAIEAG
RAAFRAGRIPRKRYASASSPIDGTIG