Protein Info for ABZR86_RS11620 in Dyella japonica UNC79MFTsu3.2

Annotation: 30S ribosomal protein S6--L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF18030: Rimk_N" amino acids 1 to 94 (94 residues), 136.1 bits, see alignment E=1.1e-43 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 2 to 285 (284 residues), 269.8 bits, see alignment E=1.3e-84 PF02655: ATP-grasp_3" amino acids 97 to 263 (167 residues), 34.2 bits, see alignment E=6.8e-12 PF08443: RimK" amino acids 97 to 285 (189 residues), 202 bits, see alignment E=1.7e-63 PF02955: GSH-S_ATP" amino acids 117 to 265 (149 residues), 56.8 bits, see alignment E=5e-19

Best Hits

Swiss-Prot: 70% identical to RIMK_XANOR: Probable alpha-L-glutamate ligase (rimK) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

KEGG orthology group: K05844, ribosomal protein S6 modification protein (inferred from 70% identity to xop:PXO_02302)

MetaCyc: 60% identical to ribosomal protein S6 modification protein (Escherichia coli K-12 substr. MG1655)
6.3.2.-

Predicted SEED Role

"Ribosomal protein S6 glutaminyl transferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HHN5 at UniProt or InterPro

Protein Sequence (292 amino acids)

>ABZR86_RS11620 30S ribosomal protein S6--L-glutamate ligase (Dyella japonica UNC79MFTsu3.2)
MKIAILSRNARLYSTQRLVEVARERGHVVRVLDPLRCYVRIAPGDVAIRYKGKPLKDIDA
VIPRIGTTSTFYGTAVLRQLEMMGVYTPNPSDAVLRARDKLRALQILASQGLDMPVTVFG
DNPDDTADVLAMLGDPPHVIKLNEGSQGTGVVLAEKRSASQSVIEAFRGLYANFLVQEFI
GEANGSDLRCFVVGGKVVAAMQRDASPGDFRANLHRGGSAQSATLSTEERQISIRAAKAL
GLGIAGVDLLRSRRGPLILEVNASPGLEGIEAATGVDVSGHIIKHLEQHARK