Protein Info for ABZR86_RS11600 in Dyella japonica UNC79MFTsu3.2

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 162 to 174 (13 residues), see Phobius details PF03033: Glyco_transf_28" amino acids 6 to 139 (134 residues), 46.1 bits, see alignment E=8.3e-16 PF00201: UDPGT" amino acids 258 to 388 (131 residues), 24.1 bits, see alignment E=2.3e-09 PF06722: EryCIII-like_C" amino acids 314 to 397 (84 residues), 37.9 bits, see alignment E=2.5e-13

Best Hits

KEGG orthology group: None (inferred from 54% identity to xal:XALc_1144)

Predicted SEED Role

"UDP-glucose:sterol glucosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HGW6 at UniProt or InterPro

Protein Sequence (440 amino acids)

>ABZR86_RS11600 glycosyltransferase (Dyella japonica UNC79MFTsu3.2)
MSARPIVIFTIGTQGDVRPCVALGQGLRRAGYPVRIATSGNFAPLVREAGLEFFPLTADF
QAMLEADRSIAEQGLNLRAMARIFRQRYAQWAEHWAEEGMAASAGAGLLIGVSNSTLLAK
ALAEKRGVPFAIARLQPLTPSRLQPPMVLSGSRDRLPGPLSLAAHHLLWLLVWHVMRPAI
NDIVRPRLGLPRYPWHGPYLGRHALEAKVLNGFSGQVLARPADWPDSSQLTGYWFFDPPA
WTPPAGLADFLAAGPKPVYIGFGSMVSSSAAEFTRIVLDGVRKSGRRAVLAAGWGGLELD
EGALDEQIYGLRQAPHDWLFPRMAGAVHHGGAGTTAAAVRAGIPSAVVPFYGDQPFWARC
LQRRGVAPPALDRRRLDADALAAALIAMQQPQMLREADALGRAIRAEDGVGEAVRLLRYW
GLLEQPDSVEIAEQPQRSVA