Protein Info for ABZR86_RS11510 in Dyella japonica UNC79MFTsu3.2

Annotation: homoserine/threonine efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 128 to 144 (17 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details PF01810: LysE" amino acids 13 to 204 (192 residues), 161.7 bits, see alignment E=7.5e-52 TIGR00949: homoserine/Threonine efflux protein" amino acids 17 to 201 (185 residues), 187.9 bits, see alignment E=7.4e-60

Best Hits

KEGG orthology group: K05835, threonine efflux protein (inferred from 63% identity to ddc:Dd586_3861)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HI00 at UniProt or InterPro

Protein Sequence (211 amino acids)

>ABZR86_RS11510 homoserine/threonine efflux transporter (Dyella japonica UNC79MFTsu3.2)
MTLFLTIALIQLIALASPGPDFFFVSQTAVSRSRRQAMFGVIGITLGALVWSALALLGLQ
ILLHRLAWLSQLIAVAGGLYLAWMGVKMLRGAWQMPAGGATQAVVVERSDFAALRAGLLT
NLANPKALVYFGSVFSAFVGDGVGAAARWGLWGLIIAETFLWFSLVAAFFALPAMRRGYL
RLTRWIDGFAGAVFVLFGLHLILRGTGNRSA