Protein Info for ABZR86_RS11390 in Dyella japonica UNC79MFTsu3.2

Annotation: YraN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR00252: TIGR00252 family protein" amino acids 2 to 115 (114 residues), 97.7 bits, see alignment E=2.3e-32 PF02021: UPF0102" amino acids 9 to 98 (90 residues), 90.1 bits, see alignment E=4.9e-30

Best Hits

Swiss-Prot: 51% identical to Y1070_PSEU5: UPF0102 protein PST_1070 (PST_1070) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K07460, putative endonuclease (inferred from 51% identity to psu:Psesu_0628)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HHV3 at UniProt or InterPro

Protein Sequence (118 amino acids)

>ABZR86_RS11390 YraN family protein (Dyella japonica UNC79MFTsu3.2)
MRVAGALFEQRACDALQQAGLSLLARNFNTRHGELDLVMRHGDTVVFVEVRHRVRATHGD
AASSVTAAKQARLISAAQLWLAAHPRHAQRPCRFDVVCYDGPVEGARMSWWRDAFQAG