Protein Info for ABZR86_RS11210 in Dyella japonica UNC79MFTsu3.2

Annotation: DedA family protein/thiosulfate sulfurtransferase GlpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 165 to 190 (26 residues), see Phobius details PF09335: SNARE_assoc" amino acids 30 to 156 (127 residues), 54.5 bits, see alignment E=1.7e-18 PF00581: Rhodanese" amino acids 208 to 303 (96 residues), 37.2 bits, see alignment E=3.5e-13

Best Hits

KEGG orthology group: None (inferred from 50% identity to hse:Hsero_1158)

Predicted SEED Role

"Alkaline phosphatase like protein" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2HML9 at UniProt or InterPro

Protein Sequence (329 amino acids)

>ABZR86_RS11210 DedA family protein/thiosulfate sulfurtransferase GlpE (Dyella japonica UNC79MFTsu3.2)
MAQEIIALLAEYGLVLVFLNVLVEQAGAPVPAVPTLVVAGALAANGQLPLLGVVGLALLG
CLLSDLAWYWAGRRYGAGVMRTLCRISLSPDSCVKQSELRFQRWRGQVLLVAKFVPGLST
VAPPLVGALGLRPAVFLLMDGLGSLLWLGLSVGLGYALAPQIDKVLVALGNAGTIALEVV
GSLLALYILLKWWQRHRLIVTLRMARITVDELKRAIDEGLGPVLVDVRSPASRLIDTRVI
PGALLADVAGIDRVVHDVPLDAELVIYCSCPNEASAAVAAKNLMQQGYRRVRPLLGGLDA
WEAAGFTILRLPAEGAEGETGNLPTQHAA