Protein Info for ABZR86_RS11145 in Dyella japonica UNC79MFTsu3.2
Annotation: gluconokinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to GCNK_GLUOX: Gluconokinase (GOX1709) from Gluconobacter oxydans (strain 621H)
KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 68% identity to pen:PSEEN2421)Predicted SEED Role
"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)
MetaCyc Pathways
- D-gluconate degradation (1/1 steps found)
- sorbitol biosynthesis II (2/3 steps found)
- L-idonate degradation (1/3 steps found)
- ketogluconate metabolism (2/8 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2JX37 at UniProt or InterPro
Protein Sequence (164 amino acids)
>ABZR86_RS11145 gluconokinase (Dyella japonica UNC79MFTsu3.2) MRAVVVMGVAGCGKSTVGAAICNRTGARMIEGDAFHPQSNIRKMSAGIPLDDADRAGWLA RLGEELASTVATGDTAVLACSALKRRYRDTLRAAAPDVGFVYLALTPTEAAERVSHRPGH FMPATLIESQFRDLETPTGEPRVLTVNATDPWPSIVDAVLAWWR