Protein Info for ABZR86_RS10985 in Dyella japonica UNC79MFTsu3.2
Annotation: LysE/ArgO family amino acid transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to Y1986_MYCTU: Putative amino-acid transporter Rv1986 (Rv1986) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 66% identity to xac:XAC3133)MetaCyc: 39% identical to L-arginine exporter (Escherichia coli K-12 substr. MG1655)
RXN66-448; TRANS-RXN-325
Predicted SEED Role
"Transporter, LysE family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2FBS3 at UniProt or InterPro
Protein Sequence (205 amino acids)
>ABZR86_RS10985 LysE/ArgO family amino acid transporter (Dyella japonica UNC79MFTsu3.2) MQTSAYLAGLAAGAGLIIAIGAQNAFVLRQGLQRRHVGPVVLVCIVADMALILLGVAGMG LLVKQMPGLLQVLRYAGAAFLAAYGALALRRAWNGESGLQPSEEGSAGRRRALLACLAFT LLNPHVYLDTVVLLGSLSTHYEGAGRWSFASGACTASALWFTALGYGARALLPVFRSPLA WRVFDVLIAAFMFVLAAALLLQPLG