Protein Info for ABZR86_RS10970 in Dyella japonica UNC79MFTsu3.2

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 10 to 256 (247 residues), 253.4 bits, see alignment E=1.1e-79 PF13512: TPR_18" amino acids 32 to 176 (145 residues), 121.6 bits, see alignment E=7.9e-39 PF13525: YfiO" amino acids 37 to 244 (208 residues), 205.4 bits, see alignment E=2.2e-64 PF13432: TPR_16" amino acids 45 to 107 (63 residues), 23.8 bits, see alignment E=1.3e-08 PF13174: TPR_6" amino acids 77 to 108 (32 residues), 17.7 bits, see alignment 1.1e-06

Best Hits

KEGG orthology group: K05807, putative lipoprotein (inferred from 42% identity to psu:Psesu_0558)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FA53 at UniProt or InterPro

Protein Sequence (279 amino acids)

>ABZR86_RS10970 outer membrane protein assembly factor BamD (Dyella japonica UNC79MFTsu3.2)
MRVTKLQLCKVLIVLAVVASMSACSMFRSKKDTIDTMPVDKLYTTAHDSLVHADYAAATK
AYQRLIARFPSGDFNEQAQLDLAYSQYKDNQPDDAYSTVNRFIKTYPTHKHVDYAYYLRG
LINFDRTGGFIERVFQRTETQARRDQGYNLQAFDDFSELTRRFPDSAYAADARQRMIYLR
NVLAQFEINVAEFYLRRKAFIASADRAQYVIEHYQQAPQTGDALAILTRSYIGLERPQLA
EQTRKVLALNYPDHPYLTDEKWPHAPSTLRKMVPFSGHH