Protein Info for ABZR86_RS10955 in Dyella japonica UNC79MFTsu3.2

Annotation: alpha,alpha-trehalose-phosphate synthase (UDP-forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 154 to 171 (18 residues), see Phobius details TIGR02400: alpha,alpha-trehalose-phosphate synthase (UDP-forming)" amino acids 8 to 457 (450 residues), 573.3 bits, see alignment E=1.7e-176 PF00982: Glyco_transf_20" amino acids 21 to 457 (437 residues), 399.8 bits, see alignment E=8.6e-124

Best Hits

Swiss-Prot: 49% identical to OTSA_ENT38: Trehalose-6-phosphate synthase (otsA) from Enterobacter sp. (strain 638)

KEGG orthology group: K00697, alpha,alpha-trehalose-phosphate synthase (UDP-forming) [EC: 2.4.1.15] (inferred from 57% identity to smt:Smal_3155)

Predicted SEED Role

"Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (EC 2.4.1.15)" in subsystem Trehalose Biosynthesis (EC 2.4.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FBR0 at UniProt or InterPro

Protein Sequence (458 amino acids)

>ABZR86_RS10955 alpha,alpha-trehalose-phosphate synthase (UDP-forming) (Dyella japonica UNC79MFTsu3.2)
MVPLRTGRLIVVSNRVALPRQTATGGLASAMRAALQEAGGVWFGWSGKIAAETAATVHHL
YDGPVHYATIDLSRGDHDHFYDGFANRTLWPLLHYRPDLVDYNRGHLDGYLRVNGIFADR
LAAVVEPDDVIWVNDYHLIPLASMLRERGVRNRIGFFLHTPLPAAGLLIALPRHRELLET
LASYDLVGLHTARDLRALEEYFVHETGARLRGGHRLRLGHRRFRAGVFPIGIDTQHVADA
AAQAGTLDPIEDLRSSLEGRALIIGVDRLDYSKGLPQRFDAYARLLERAPRLHRRVSFLQ
IAPPSRSTVPEYRQIRRDLERKAGHINGMYAAPDWVPIRYVNKSFPHSVLSGYYRNAKVG
LVTPMRDGMNLVAKEYVASQNPDDPGVLVLSRFAGAAQELGEALLVNPADTEEVADALEL
ALAMPLEERRQRWRAMMDVLEQQDITAWRRSFVAALRE