Protein Info for ABZR86_RS10945 in Dyella japonica UNC79MFTsu3.2

Annotation: trehalose-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00685: trehalose-phosphatase
  • amino acids 27 to 258 (232 residues), 140.5 bits, E=9e-45
• TIGR01484: HAD hydrolase, family IIB
  • amino acids 30 to 221 (192 residues), 61.3 bits, E=1.4e-20
• PF02358: Trehalose_PPase
  • amino acids 31 to 247 (217 residues), 114.9 bits, E=1.7e-37

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

• trehalose biosynthesis I (2/2 steps found)
• trehalose biosynthesis II (1/2 steps found)
• trehalose biosynthesis III (1/2 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Sequence Analysis Tools

See A0A1I2FAJ1 at UniProt or InterPro

Protein Sequence (276 amino acids)

>ABZR86_RS10945 trehalose-phosphatase (Dyella japonica UNC79MFTsu3.2)
MSFSPAFPRMSAITPLPAPPLPGTGDRWALFLDVDGTLLEFADRPDDVRVEPELYALLAE
LYAHLEGALALVSGRSLAGLDALFGAPPWAMAGLHGLQLRHADGEQRETRISASRRALVL
HAAESIAREHPGVLVENKSLAVALHCRAAPVHYEALREAVLALLPGLPGYELQAGNLVLE
LKPAGMDKGKAVTELLERAPFAGRLPVYLGDDLTDEHGFAATNLENGISVRVGEREPTLA
QYTLPGPSSAQAWLQRVLNVLKQGVEPYAHALGGNA