Protein Info for ABZR86_RS10915 in Dyella japonica UNC79MFTsu3.2

Annotation: cobyrinate a,c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13500: AAA_26
  • amino acids 10 to 182 (173 residues), 30 bits, E=6.9e-11
• PF01656: CbiA
  • amino acids 12 to 188 (177 residues), 48.5 bits, E=1.2e-16
• PF07685: GATase_3
  • amino acids 240 to 420 (181 residues), 91.1 bits, E=1.1e-29

Best Hits

Swiss-Prot: 62% identical to COBB_PSEAE: Hydrogenobyrinate a,c-diamide synthase (cobB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 70% identity to xca:xccb100_1131)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (20/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (20/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (3/13 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (4/15 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

See A0A1I2FD30 at UniProt or InterPro

Protein Sequence (431 amino acids)

>ABZR86_RS10915 cobyrinate a,c-diamide synthase (Dyella japonica UNC79MFTsu3.2)
MSGVRHAPALLVSAPASGQGKTSFTAALARAHARQGRRVRVFKTGPDFLDPMVLARASGA
PVYQLDLWMNGEADVRARLYEAAGEAELILIEGVMGLFDGGTSSADLAQRLGLPVLAVID
GSAMAQTFGAVAMGLARYREGLRVHGVAANRIGGAYHAKLLAESLPTGLRWFGALPRDPA
LALPERHLGLVAAGELADLEQRLDALADALEKHAELALPPPVAFSAADAPVVPRMLQGRR
IAIARDDAFCFLYPANLDLLRQAGAELRWFSPLAGEALPECDAAWLPGGYPELHLPRLAA
RTDLHAALRAHVDAGKPLLAECGGMLSLLDALATREGDAYTMAGLLPGWAVVRERLAGLG
MQSVELPEGRLRGHTFHYAHAEVAQPPLVRAANPDGGPANEAVYRRARLTASFVHFYFPS
APEAALRLFLP