Protein Info for ABZR86_RS10785 in Dyella japonica UNC79MFTsu3.2

Annotation: 7-cyano-7-deazaguanine synthase QueC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF06508: QueC" amino acids 8 to 222 (215 residues), 256 bits, see alignment E=2.4e-80 TIGR00364: queuosine biosynthesis protein QueC" amino acids 9 to 215 (207 residues), 194.7 bits, see alignment E=6.5e-62 PF00733: Asn_synthase" amino acids 11 to 67 (57 residues), 29.3 bits, see alignment E=7.1e-11

Best Hits

Swiss-Prot: 74% identical to QUEC_XANOP: 7-cyano-7-deazaguanine synthase (queC) from Xanthomonas oryzae pv. oryzae (strain PXO99A)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 76% identity to xal:XALc_2419)

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FEY8 at UniProt or InterPro

Protein Sequence (231 amino acids)

>ABZR86_RS10785 7-cyano-7-deazaguanine synthase QueC (Dyella japonica UNC79MFTsu3.2)
MSQTSLPRAVVLVSGGMDSAVTIAIAREQGYQVHALSVAYGQRHSSELEASARVSRLLGA
VEHKTVQVDLRSIGGSALTADIDVPLDADLHGDSGGIPITYVPARNTIMLSIALGWAEVL
GSSDIWCGVNAVDYSGYPDCRPAFIEAFESLANVATKAGVEGAGIRVHAPLMRMSKADIA
REGARLGVDFSETVSCYQADAQGRACGHCDACRLRAQGFRDAGLADPTRYA