Protein Info for ABZR86_RS10725 in Dyella japonica UNC79MFTsu3.2

Annotation: energy-dependent translational throttle protein EttA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 2 to 552 (551 residues), 983.1 bits, see alignment E=3.8e-300 PF00005: ABC_tran" amino acids 21 to 190 (170 residues), 90 bits, see alignment E=3.4e-29 amino acids 339 to 472 (134 residues), 88.2 bits, see alignment E=1.2e-28 PF12848: ABC_tran_Xtn" amino acids 229 to 305 (77 residues), 47 bits, see alignment E=3.4e-16

Best Hits

Swiss-Prot: 73% identical to ETTA_ECOLI: Energy-dependent translational throttle protein EttA (ettA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 82% identity to psu:Psesu_0614)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FE31 at UniProt or InterPro

Protein Sequence (553 amino acids)

>ABZR86_RS10725 energy-dependent translational throttle protein EttA (Dyella japonica UNC79MFTsu3.2)
MQYIYTMNGVSKIVPPKRQIIKDISLSFFPGAKIGLLGLNGAGKSTVLRIMAGVDTDFQG
EARPQPGIKVGYLAQEPQLDAEKTVREAVEEGVSVVLDAQKRLEEVYAAYAEEGADFDKL
AAEQQELENILAVNDAHALERQLEVAADALRLPPWDAKIGPLSGGEKRRVALCRLLLSKP
DMLLLDEPTNHLDAESVDWLEQFLQNYPGTVVAVTHDRYFLDNAAEWILELDRGRGIPWK
GNYTEWLEQKDARLKQEASQEKSRQKAIEKELEWVRSAAKGRQSKGKARLNRFEELNSVE
YQHRNETNEIFIPPGERLGQEVIEFKNVSKAFGDRLLIDDLSFKVPPGAIVGVIGPNGAG
KSTLMKLITGKEQPDSGEVKLGHTVKLAYVDQSRGMLDAKNNVWQEISGGLDILTIGNFE
IQSRAYIGRFNFKGTDQQKIVGNLSGGERGRLHLAKTLLQGGNMLLLDEPSNDLDVETLR
ALEDALLEFPGCAMVISHDRWFLDRIATHILAFEGDSHVEFFPGNYNEYEADKKRRLGDE
AAKPHRVKYKKLA