Protein Info for ABZR86_RS10675 in Dyella japonica UNC79MFTsu3.2

Annotation: bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase" amino acids 3 to 199 (197 residues), 236.3 bits, see alignment E=1.2e-74 PF00926: DHBP_synthase" amino acids 8 to 198 (191 residues), 282.5 bits, see alignment E=1.4e-88 PF00925: GTP_cyclohydro2" amino acids 207 to 363 (157 residues), 130.7 bits, see alignment E=4.1e-42

Best Hits

Swiss-Prot: 50% identical to RIBBA_CHLL7: Riboflavin biosynthesis protein RibBA (ribBA) from Chlorobium luteolum (strain DSM 273 / 2530)

KEGG orthology group: K14652, 3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC: 3.5.4.25 4.1.99.12] (inferred from 68% identity to xca:xccb100_3659)

Predicted SEED Role

"3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Riboflavin, FMN and FAD metabolism or Molybdenum cofactor biosynthesis (EC 3.5.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25 or 4.1.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FGD9 at UniProt or InterPro

Protein Sequence (363 amino acids)

>ABZR86_RS10675 bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II (Dyella japonica UNC79MFTsu3.2)
MAFNTIPEILEDIRAGRMVVILDDEDRENEGDLIMAAQMVRPEDINFMVREARGLVCLTL
TEQRTRQLGLRPMVSDNTSPYHTNFTVSIEAAEGVTTGISAHDRARTIQVAVKSDARPQD
LSQPGHIFPLTAQPGGVLTRAGHTEAGCDLAALAGLEPSAVLIEILHEDGSMARRPELEI
FARKHGLKIGSIADLIRYRLETEKTVERVHEEQVETEFGPFHLVAYRDAIRRGLHFALVR
GAVDDGAPVLTRVHVRNTLSDVLHLQREDLGLTVTSALRRIADEGRGVLLVLSGEDTPEA
LLRRLNRQPAAQEPEEAQQQEWRQLGLGAQMLADLGVQRLRVLGTPRKLVGLGGFGLEVV
EHV