Protein Info for ABZR86_RS10505 in Dyella japonica UNC79MFTsu3.2

Annotation: ribosomal protein S18-alanine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 18 to 149 (132 residues), 125.6 bits, see alignment E=7.4e-41 PF00583: Acetyltransf_1" amino acids 31 to 127 (97 residues), 62.7 bits, see alignment E=8.2e-21 PF13673: Acetyltransf_10" amino acids 42 to 132 (91 residues), 42.5 bits, see alignment E=1.2e-14 PF13508: Acetyltransf_7" amino acids 49 to 129 (81 residues), 44.6 bits, see alignment E=3e-15 PF08445: FR47" amino acids 74 to 130 (57 residues), 27.5 bits, see alignment E=5e-10

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 63% identity to psu:Psesu_2430)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FH91 at UniProt or InterPro

Protein Sequence (156 amino acids)

>ABZR86_RS10505 ribosomal protein S18-alanine N-acetyltransferase (Dyella japonica UNC79MFTsu3.2)
MVAVARPHAEVRAMRREDLPGVAALERAAYDFPWSEGIFGDCLKAGHPSWVLWVEGEMAG
YGVLSVAAGEAHVLNLCIGQNHRGLGLGRHLLRRLLDVARWNGAERVFLEVRPSNPVAQT
LYRSIGFEEIGRRPNYYPAKQGREDAIVMALDLVAP