Protein Info for ABZR86_RS10480 in Dyella japonica UNC79MFTsu3.2

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR01357: 3-dehydroquinate synthase" amino acids 19 to 358 (340 residues), 366 bits, see alignment E=9.9e-114 PF00465: Fe-ADH" amino acids 22 to 185 (164 residues), 29.4 bits, see alignment E=5.8e-11 PF13685: Fe-ADH_2" amino acids 23 to 236 (214 residues), 40.1 bits, see alignment E=5.7e-14 PF01761: DHQ_synthase" amino acids 72 to 329 (258 residues), 340 bits, see alignment E=1.2e-105

Best Hits

Swiss-Prot: 62% identical to AROB_XANCP: 3-dehydroquinate synthase (aroB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 62% identity to psu:Psesu_0770)

MetaCyc: 50% identical to 3-dehydroquinate synthase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate synthase. [EC: 4.2.3.4]

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FKE4 at UniProt or InterPro

Protein Sequence (366 amino acids)

>ABZR86_RS10480 3-dehydroquinate synthase (Dyella japonica UNC79MFTsu3.2)
MTDTPTLRSIDVALGQRSYPVWIGPGLLDDRARWRAMLRGRHALVISNTTVAPLYLERVA
AGLEGLQWSAFLLDDGEAHKTFDNVGRALDALAQLGATRDACVVALGGGVVGDLAGFSAA
CWMRGIDFIQMPTTLLAMVDSSVGGKTGVNLPAGKNLVGAFHQPRAVIADIDTLATLPQR
EYRAGLAEVVKGAAIGDLPFFAWLEQHADALAARDTAPLIEAIARKVQYKAGVVARDETE
QGERALLNLGHTFGHALETAGKYTTLLHGEGVAVGMLLAARLSERLGMSAAADTARLQRL
LERLGLPVAIPPGMDPQALLALMRLDKKNTAGTLRLILWRGIGRAEIVGGVDEREVLATL
HEATAA