Protein Info for ABZR86_RS10475 in Dyella japonica UNC79MFTsu3.2

Annotation: shikimate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01202: SKI
  • amino acids 14 to 163 (150 residues), 153.3 bits, E=3.1e-49

Best Hits

Swiss-Prot: 45% identical to AROK_HISS2: Shikimate kinase (aroK) from Histophilus somni (strain 2336)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 49% identity to psu:Psesu_0771)

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of L-tyrosine biosynthesis (9/10 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.71

Sequence Analysis Tools

See A0A1I2FKG8 at UniProt or InterPro

Protein Sequence (179 amino acids)

>ABZR86_RS10475 shikimate kinase (Dyella japonica UNC79MFTsu3.2)
MNPSCNLFIVGPTGAGKTSIGRRLAAHYELEFLDLDQEIERHCGATVSTVFELEGEAGFR
RRESTLLDACTARSGVLLATGAGAVLDPDNRRLLAGRGYVLWLQATLEQQLERLARDRSR
PLLAGEDRSAKLQAMAGIRTPLYADVADLVIPGEHELVQAASERSIALIDQHWQRQQAA