Protein Info for ABZR86_RS10215 in Dyella japonica UNC79MFTsu3.2

Annotation: inositol monophosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00459: Inositol_P
  • amino acids 5 to 257 (253 residues), 175.9 bits, E=6e-56

Best Hits

KEGG orthology group: None (inferred from 59% identity to tkm:TK90_2248)

Predicted SEED Role

"Histidinol-phosphatase [alternative form] (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.15

Use Curated BLAST to search for 3.1.3.15

Sequence Analysis Tools

See A0A1I2IJ75 at UniProt or InterPro

Protein Sequence (262 amino acids)

>ABZR86_RS10215 inositol monophosphatase family protein (Dyella japonica UNC79MFTsu3.2)
MSAPDLQRALSAAREAAEAAAEVIRHYWRRGVEVEIKSDATPVTIADREAELAIRKVLQA
ALPEAAIYGEEFGLDDGARELLWLVDPLDGTKSFVRRTPFFSTQIALMHKGELVLGVSSA
PVYGETLWASAGGGAWFEGDRVRVAATDSMAQASISTGNVKTLTMDARWAELGAMIRDSN
RIRGYGDFCHYHLLARGGLDLVIESDVNILDVAALAAIVREAGGLFTDLDGQPLTLDTRS
VLAGTPALHAQALTRFRASLQS