Protein Info for ABZR86_RS10205 in Dyella japonica UNC79MFTsu3.2

Annotation: 3'(2'),5'-bisphosphate nucleotidase CysQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01331: 3'(2'),5'-bisphosphate nucleotidase" amino acids 9 to 256 (248 residues), 288.6 bits, see alignment E=2.3e-90 PF00459: Inositol_P" amino acids 12 to 249 (238 residues), 157.4 bits, see alignment E=2.8e-50

Best Hits

KEGG orthology group: K03677, CysQ protein (inferred from 54% identity to hna:Hneap_0525)

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IJB7 at UniProt or InterPro

Protein Sequence (272 amino acids)

>ABZR86_RS10205 3'(2'),5'-bisphosphate nucleotidase CysQ (Dyella japonica UNC79MFTsu3.2)
MSMAPVSPLLRQVAAIARDAAAAILVVYEQDFAVQRKEDHSPVTDADLAAQHVIMAGLEA
LDEQLPVLSEESRIASWKERQAWSRYWLVDPLDGTREFVKRNGEFTVNIALIDGDEPVLG
VVLAPVTGDLYAAERGGRAWRQEHAGAEWQPIATRAITQPPVVAGSRSYGGHGAALLREL
LGDEVVETPMGSSLKFCLLARGAADVYLRRGATSEWDTAAAQCVLEAAGGAVLDLTGARL
RYNRKDSLLNPEFIAVGDTAIDWTARLRAADV