Protein Info for ABZR86_RS10200 in Dyella japonica UNC79MFTsu3.2

Annotation: nucleoside triphosphate pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00444: MazG family protein
  • amino acids 15 to 264 (250 residues), 319.7 bits, E=7.1e-100
• PF03819: MazG
  • amino acids 32 to 105 (74 residues), 106.6 bits, E=6.5e-35
  • amino acids 173 to 233 (61 residues), 32.3 bits, E=1e-11
• PF01503: PRA-PH
  • amino acids 172 to 227 (56 residues), 21.8 bits, E=1.9e-08

Best Hits

Swiss-Prot: 55% identical to MAZG_ECOLI: Nucleoside triphosphate pyrophosphohydrolase (mazG) from Escherichia coli (strain K12)

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 70% identity to sml:Smlt3663)

MetaCyc: 55% identical to nucleoside triphosphate pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• dZTP biosynthesis (4/5 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (2/3 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Pyrimidine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.9

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.8 or 3.6.1.9

Sequence Analysis Tools

See A0A1I2IHI5 at UniProt or InterPro

Protein Sequence (270 amino acids)

>ABZR86_RS10200 nucleoside triphosphate pyrophosphohydrolase (Dyella japonica UNC79MFTsu3.2)
MTETTRHSLDDLLAIMARLRDPQRGCPWDVQQDFATIAPYTIEEAYEVADAIDRKDWHDL
RDELGDLLLQVVFHAQMAQEQGLFDFADVAHAISDKMIRRHPHVFGDVSYDDVEAQKEAW
EAIKAEERAAKGESHDDSALAGVSRGLPEWKRALKLQQRAAKVGFDWPDEQPVLDKLAEE
IEEVRAEFAAGADKARLQDEIGDVAFVLVNLARHADVDFSQALRHANEKFERRFRGMEAL
AREEGVPLAERGLEAQEALWQRVKGGEVLP