Protein Info for ABZR86_RS10150 in Dyella japonica UNC79MFTsu3.2

Annotation: 3-oxoacid CoA-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 TIGR02429: 3-oxoacid CoA-transferase, A subunit" amino acids 1 to 216 (216 residues), 252.5 bits, see alignment E=3e-79 PF01144: CoA_trans" amino acids 6 to 216 (211 residues), 246.4 bits, see alignment E=1.1e-77 amino acids 242 to 438 (197 residues), 172.1 bits, see alignment E=6e-55 TIGR02428: 3-oxoacid CoA-transferase, B subunit" amino acids 241 to 445 (205 residues), 312.3 bits, see alignment E=1.2e-97

Best Hits

KEGG orthology group: K01027, 3-oxoacid CoA-transferase [EC: 2.8.3.5] (inferred from 80% identity to dar:Daro_1021)

Predicted SEED Role

"Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5) / Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B (EC 2.8.3.5)" in subsystem Catechol branch of beta-ketoadipate pathway or Leucine Degradation and HMG-CoA Metabolism or Protocatechuate branch of beta-ketoadipate pathway or Serine-glyoxylate cycle (EC 2.8.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IM98 at UniProt or InterPro

Protein Sequence (451 amino acids)

>ABZR86_RS10150 3-oxoacid CoA-transferase (Dyella japonica UNC79MFTsu3.2)
MDKVYASAAQALDGLLFDDMTIAAGGFGLCGIPENLIAALLAAGTKGLTIVGNNAGVDDF
GMGPLLKTRQVKRVYASYVGENKEFERQVLAGELELHLVPQGTLAEKLRAGGAGIPGFYT
RTAFGTKLAEGKETKVFDGKEYVLEEAIHADVSIVKAWKGDRLGNLVFRKTARNFNPMIA
TCGKLCVAEVEELVEVGTLEPDQVHVPGIYVDRIIQGPSYEKRIEFRTVAGANTGKESPL
RTAMAQRAAKELRDGFYVNLGIGIPTLVANFIPAGIDVTLQSENGLLGIGPFPDDAHVDP
DLINAGKQTITTLPGSSFFSSAESFAMIRGGHIDLSILGGLEVSCTGDLANWMVPGKMVK
GPGGAMDLVSGVKRVVVLMEHTAKDGSPKIKNQCDLPLTGQQVVDLIITDLCVFEVEKGK
GLTLIELQEGVTVEEVKAKTGCDFAVASTLG