Protein Info for ABZR86_RS10080 in Dyella japonica UNC79MFTsu3.2

Annotation: prolyl oligopeptidase family serine peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02129: Peptidase_S15" amino acids 402 to 548 (147 residues), 40.3 bits, see alignment E=1.1e-13 PF00756: Esterase" amino acids 407 to 605 (199 residues), 29.1 bits, see alignment E=2.9e-10 PF20434: BD-FAE" amino acids 413 to 607 (195 residues), 41.5 bits, see alignment E=3.9e-14 PF00326: Peptidase_S9" amino acids 441 to 648 (208 residues), 171.3 bits, see alignment E=7.2e-54 PF01738: DLH" amino acids 445 to 632 (188 residues), 41.5 bits, see alignment E=4e-14 PF08386: Abhydrolase_4" amino acids 571 to 643 (73 residues), 26.9 bits, see alignment E=1.6e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IKJ0 at UniProt or InterPro

Protein Sequence (656 amino acids)

>ABZR86_RS10080 prolyl oligopeptidase family serine peptidase (Dyella japonica UNC79MFTsu3.2)
MPYRFARTALSVLCLLAPAAACAADLVPVEDFARHPQISMPRLSPDGKYVAVRADTDDGD
NHALVVYQISDMSAPVSTLRMPKYELPTSIVWVSPTRLVIEKGKQFGSIDKPMSTGEIIA
TDVNGKNQDYLYGYESNLGTRGGTRGADHGWGSIDGLPEQANGHFYMGSQSWDTTNQSSL
YDVNAQKNTRALIGDIGVGGMTFMTGADGKAHFAYGHDENYQFVVFHRENNAWARLGVQS
TGASFAPIGFTPDHQHIYASYSPDGGPVRLVEQEETGGNRRELGKDEFGSVGMLQWSPLP
SQPFAYSALTGVPRLVYTDSNLPTAKLHMALSLKFPGKVVDFINYSEDGGQLLFSVTSDR
DPGAYLLIDTHTYKVTKLFDVAPWIDPNKMAERRPLRFKASDGMELEAILTLPKGAGEAN
LPMVLLPHGGPHDVQDTWFYDDDAQFLASRGYLVLQVNYRGSGGRGANFKEAGYLKWGTR
IQQDLIDGVKWAIAEKYADASRICVYGGSFGGYSAMMTTIRAPGMFKCAVGYAGIYDLDM
MYNKGDIASNKRGRNYLRTVIGRNDADLAANSPDKLADKIDVPVLLVHGEADQRAPFAQA
KAMRAALEAAHKPYQWLSKSGEGHGFYDEKNNIEFYNTLQAFLDKYIGPKASVASN