Protein Info for ABZR86_RS10045 in Dyella japonica UNC79MFTsu3.2

Annotation: type II secretion system F family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 187 to 210 (24 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details PF00482: T2SSF" amino acids 88 to 211 (124 residues), 112.1 bits, see alignment E=8.9e-37 amino acids 292 to 414 (123 residues), 108.9 bits, see alignment E=8.6e-36

Best Hits

Swiss-Prot: 50% identical to TAPC_AERHY: Type IV pilus assembly protein TapC (tapC) from Aeromonas hydrophila

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 61% identity to xal:XALc_0665)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IP93 at UniProt or InterPro

Protein Sequence (422 amino acids)

>ABZR86_RS10045 type II secretion system F family protein (Dyella japonica UNC79MFTsu3.2)
MATAVTAAKDARARGAARAAVSQLTMYDWIALDKRGKRMKGEMPAKNASLVKAELRRQGM
NPQTVREKSKPLFGAAGSKVKPRDVAIFSRQIATMMASGVPMVQSFDIIADGQKNVRFKN
MLVDVKQNIEGGAALHEALGKYPVEFDELYRNLVHAGESAGVLDTVLDTVATYKERMEGI
KSKIKKALFYPVMVLVVAMLVSMILLLFVVPVFQQTFKDAGAELPAPTQIVISASQFMQS
YWYVVIGVIVGSIVALVMAKNRSPAVAHFLDRVMLRLPVIGNILRQSAIARFARTLGVTF
RAGVPLVEAMEAVAGATGSIVYGDAVRQMRDDVAVGHQLQLAMRQTGLFPNMVVQMTAIG
EESGALDNMLFKVAEFYEEEVNNAVDTLSTLLEPLIMVILGVLVGGMVVSLYLPIFKLAG
TV