Protein Info for ABZR86_RS09985 in Dyella japonica UNC79MFTsu3.2

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 259 to 281 (23 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 18 to 224 (207 residues), 65 bits, see alignment E=2e-21 PF00535: Glycos_transf_2" amino acids 19 to 174 (156 residues), 87.8 bits, see alignment E=1.6e-28 PF13506: Glyco_transf_21" amino acids 86 to 212 (127 residues), 22.9 bits, see alignment E=1.1e-08 PF13632: Glyco_trans_2_3" amino acids 97 to 272 (176 residues), 28.9 bits, see alignment E=2.1e-10

Best Hits

KEGG orthology group: None (inferred from 50% identity to dol:Dole_0524)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IJJ0 at UniProt or InterPro

Protein Sequence (349 amino acids)

>ABZR86_RS09985 glycosyltransferase (Dyella japonica UNC79MFTsu3.2)
MELAETSSPVKHTDRIVCSICIANYNGEQLLDDCLASILAQENAPSIEVIVHDDASTDSS
VELIRQKYPSVKLLQSADNVGFCVANNRMVAAAAGDYVLLLNNDAALFPDALSKLLEQVE
AGPDNILTLPQYDWVTHRLVDRGCLLDYFYNPIPNLDADRTDVAMVIGACLWIPRRLWIE
LDGFPTWMESIAEDLYLCSIARLRGHEVRVVPGSGYRHRQGASFGGNKPSQSKLASTMRR
RRLSERNKSYALFICTPTPAMWALLALHALLLIAEGLVLSAWRRNPRIFLDIYWNAVTSV
VKERARLRSTRNQLMKLKATSNRRYFSVFARMPRKLSMLRQFGVPDIGK