Protein Info for ABZR86_RS09940 in Dyella japonica UNC79MFTsu3.2

Annotation: magnesium/cobalt transporter CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 286 to 305 (20 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 44 to 343 (300 residues), 204.5 bits, see alignment E=1.4e-64 PF01544: CorA" amino acids 53 to 339 (287 residues), 221.9 bits, see alignment E=6e-70

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 60% identity to smt:Smal_1347)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IPC6 at UniProt or InterPro

Protein Sequence (343 amino acids)

>ABZR86_RS09940 magnesium/cobalt transporter CorA (Dyella japonica UNC79MFTsu3.2)
MRGMVLSTRTASTPDDAKPAMVVNCVAYNTRDGKRIGDVTLDAISDVLKEPDTFVWVGLH
EPDESLLLKLQEEFDLHDLAIEDAQAAHQRTKIEAYGESLFIVVQTAQLVNGHIAFGETH
IFLGARYLVTVRHGASLSYAPARRACEHTPDLLALGPSYGLYGVLDFIVDNLLPIVREFK
EELQELEQDIFGDTFKRRTVRRLYDMQRDLMTLRLAVAPLQDIISQLVRMHPHLIPDELR
AYFRDVYDHVFRVNESISAMREMLSAAININLSLVTFNQNEVMKKLAGWAAMLAAPTLIT
SWYGMNFHHMPELDKTWAYPAMIALVVGVVAGIYYWLKRSRWL