Protein Info for ABZR86_RS09885 in Dyella japonica UNC79MFTsu3.2

Annotation: trypsin-like peptidase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details PF00089: Trypsin" amino acids 115 to 278 (164 residues), 73 bits, see alignment E=1e-23 PF13365: Trypsin_2" amino acids 119 to 252 (134 residues), 126.4 bits, see alignment E=4.6e-40 PF00595: PDZ" amino acids 309 to 366 (58 residues), 31.6 bits, see alignment E=5.4e-11 PF13180: PDZ_2" amino acids 313 to 381 (69 residues), 40.2 bits, see alignment E=1.1e-13 PF17820: PDZ_6" amino acids 317 to 353 (37 residues), 27.4 bits, see alignment 7.1e-10

Best Hits

KEGG orthology group: K04691, serine protease DegS [EC: 3.4.21.-] (inferred from 52% identity to aeh:Mlg_2213)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IMJ7 at UniProt or InterPro

Protein Sequence (395 amino acids)

>ABZR86_RS09885 trypsin-like peptidase domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MKQAVGTLAFIARFVVLGLAVAFVISLLWPGVGDRLRAGVGLHSAQAPGSGTSAPTIRGR
SSGPVSYADAVARAAPSVVNIYANKMVTEQGVQMYSDPVLQRLFGGRPAIYKRREQSLGS
GVIVSSQGYVLTNNHVIAKADDIQVLLYDGRVAKAQLVGADAETDLAVLKIDVSSPPVIP
FADEHPARTGDVVLAIGNPLGLNQTVTMGIISAIGRQLSSSSPEDFIQTDAAINLGNSGG
ALVNTDGELVGINTLLIGKAANAEGISFAIPASSARKVLEQIIDSGHVVRGWLGVDYTFV
PVAADSGLPAAARGAQVSDVYPGGPAAQAGIQPHDILLRIGKDDIVDAADLRRREAALPP
GSKVEVSGLRNGTPFHAEVTLAQRPPLTPTASLDG