Protein Info for ABZR86_RS09875 in Dyella japonica UNC79MFTsu3.2

Annotation: cytochrome bc complex cytochrome b subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 38 to 61 (24 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 357 to 383 (27 residues), see Phobius details amino acids 396 to 414 (19 residues), see Phobius details PF00033: Cytochrome_B" amino acids 28 to 216 (189 residues), 229.1 bits, see alignment E=6e-72 PF13631: Cytochrom_B_N_2" amino acids 98 to 274 (177 residues), 148.8 bits, see alignment E=2.3e-47 PF00032: Cytochrom_B_C" amino acids 286 to 380 (95 residues), 107.3 bits, see alignment E=6.9e-35

Best Hits

Swiss-Prot: 62% identical to CYB_ALLVD: Cytochrome b (petB) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 72% identity to smt:Smal_1362)

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IPY7 at UniProt or InterPro

Protein Sequence (434 amino acids)

>ABZR86_RS09875 cytochrome bc complex cytochrome b subunit (Dyella japonica UNC79MFTsu3.2)
MATVFSRIGDWVNERAPNLAPTYRKHMTEYYAPKNFNLWYYFGSLALLVLVNQIVTGIFL
TMNYKTSAAEAFASVEYIMRDVEWGWLIRYMHSTGASLFFVVVFLHMFRGLMYGSYQKPR
ELVWLLGMLIFLVLMAEAFMGYVLPWGNMSFWGAKVIISLFGTIPVIGNSLVEWIMGDYL
PADATLNRFFALHVIALPLVLLLLVVLHLAALHEVGSNNPDGVDVKHGPKGNRWDASKPA
DAIPFHPYYTVKDLVGVGFFLIIAAFIIFFAPTFGGWFLEHDNFVPANNLVTPTHIKPVW
YFTPFYAILRMIPSLFSTAIWGVLGMFGAIVLLFLLPWIDAGKVRSIRYRGTGFKVALGL
FVLSFIALGAVGAGVVAEVIPAWFGNVDVTFWENSFGRLWTLVYFGFFVFMWVYTRGGRE
KTRPVPERVVYDHD