Protein Info for ABZR86_RS09860 in Dyella japonica UNC79MFTsu3.2

Annotation: ClpXP protease specificity-enhancing factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 73 to 89 (17 residues), see Phobius details PF04386: SspB" amino acids 4 to 139 (136 residues), 131.2 bits, see alignment E=1.8e-42

Best Hits

Swiss-Prot: 51% identical to SSPB_HAEIN: Stringent starvation protein B homolog (sspB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03600, stringent starvation protein B (inferred from 55% identity to smt:Smal_1365)

Predicted SEED Role

"Stringent starvation protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IQ51 at UniProt or InterPro

Protein Sequence (140 amino acids)

>ABZR86_RS09860 ClpXP protease specificity-enhancing factor (Dyella japonica UNC79MFTsu3.2)
MSSNRPYLLRAIYDWITDNNLTPYILVDAAREGVRVPPQVVKNGQVVLNLAMRAVANLDL
GNEWISFQARFSGVSHSILIPVHAVLALYAQENGQGMMFPADEGGDQPPPEPPSDDTPPP
DSPDTGDKPRKGAPFLRVVK