Protein Info for ABZR86_RS09850 in Dyella japonica UNC79MFTsu3.2

Annotation: carboxylating nicotinate-nucleotide diphosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 19 to 281 (263 residues), 319.7 bits, E=6.8e-100
• PF02749: QRPTase_N
  • amino acids 27 to 115 (89 residues), 84 bits, E=5.9e-28
• PF01729: QRPTase_C
  • amino acids 118 to 281 (164 residues), 204 bits, E=1.4e-64

Best Hits

Swiss-Prot: 60% identical to NADC_PSEAE: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 63% identity to mca:MCA3101)

MetaCyc: 52% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• aspartate superpathway (21/25 steps found)
• NAD de novo biosynthesis II (from tryptophan) (8/9 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
• NAD de novo biosynthesis I (4/6 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (4/6 steps found)
• nicotine biosynthesis (1/9 steps found)
• superpathway of nicotine biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

See A0A1I2IKZ2 at UniProt or InterPro

Protein Sequence (285 amino acids)

>ABZR86_RS09850 carboxylating nicotinate-nucleotide diphosphorylase (Dyella japonica UNC79MFTsu3.2)
MTSSNLLAPPPAELVLADVERAFAEDIGSGDATAELLPAGANAKATLTCREDAVIAGTAW
FDACFRRLDPAVRIDWQAGDGARVAPGSVICRLEGRARALVSAERSALNFLQLLSGTATT
TAAYVQAVAGTAVRVLDTRKTVPGLRIAQKYAVRCGGGHNHRVGLYDAILVKENHIIAAG
GIAQAVEAARRLHPRLLLEVEVENLDELQQAIEAGVDRIMIDNFTPPLMREAVAIAAGRI
PLEISGNVDLDTIRTYAETGVDFISVGALTKHVRAVDLSLRLQLD