Protein Info for ABZR86_RS09820 in Dyella japonica UNC79MFTsu3.2

Annotation: Grx4 family monothiol glutaredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 TIGR00365: monothiol glutaredoxin, Grx4 family" amino acids 4 to 99 (96 residues), 138.4 bits, see alignment E=3.7e-45 PF00462: Glutaredoxin" amino acids 16 to 80 (65 residues), 72.8 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 48% identical to GLRX4_PASMU: Glutaredoxin 4 (grxD) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K07390, monothiol glutaredoxin (inferred from 69% identity to xal:XALc_1275)

Predicted SEED Role

"Glutaredoxin-related protein" in subsystem Glutaredoxins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IQN8 at UniProt or InterPro

Protein Sequence (108 amino acids)

>ABZR86_RS09820 Grx4 family monothiol glutaredoxin (Dyella japonica UNC79MFTsu3.2)
MDVNERIKAVLAEHPIVLFMKGTPQFPMCGFSSRAAQALKEAGAEVHAVNVLADPEVRAA
LPHYANWPTFPQLFIQGELIGGCDIVEDLKASGELARMVLDVSGASQA