Protein Info for ABZR86_RS09705 in Dyella japonica UNC79MFTsu3.2

Annotation: CopD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details PF03653: UPF0093" amino acids 2 to 148 (147 residues), 125.7 bits, see alignment E=9.1e-41

Best Hits

KEGG orthology group: K08973, putative membrane protein (inferred from 60% identity to xac:XAC1402)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I9V7 at UniProt or InterPro

Protein Sequence (148 amino acids)

>ABZR86_RS09705 CopD family protein (Dyella japonica UNC79MFTsu3.2)
MTYLWIKSLHLLFVMAWVASIFYLPRILVNIAEAGSEPATKARLELMGTRLYRFGHNMFG
MALLFGATLWQGWRLFPGTLPNFGQAEWLYAKLTLVVLLLVYYVWTGRLVKRSARGGALP
SAKTLRLMNELPVFVLLGIIFLVIAKPF