Protein Info for ABZR86_RS09630 in Dyella japonica UNC79MFTsu3.2

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 228 to 246 (19 residues), see Phobius details PF01565: FAD_binding_4" amino acids 47 to 185 (139 residues), 141.6 bits, see alignment E=1.4e-45 PF02913: FAD-oxidase_C" amino acids 224 to 466 (243 residues), 192.8 bits, see alignment E=8.8e-61

Best Hits

KEGG orthology group: None (inferred from 77% identity to psu:Psesu_1804)

Predicted SEED Role

"D-2-hydroxyglutarate dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IB90 at UniProt or InterPro

Protein Sequence (467 amino acids)

>ABZR86_RS09630 FAD-binding oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MTAPAQSPKVAALAELAARLPGLRLLTAPADLEHYGRDWTRRWTPAPLAIALPATVEEAQ
AVLRWANEHGVAVVPSGGRTGLSGGAVAAQGELVLSLERMNRVLGFDPIDRTLTVQAGIA
LQAVHDAARSHGLIYPVDFAARGSCSIGGNIATNAGGIRVIRYGNTREWIAGLKVIAGNG
ELLELNRGLIKNSSGYDLRHLTIGSEGTLGIVVEATLRLAEPPPPSQVMLLALPDMAALM
QVFALFRARLKLQAFEFFTDIALRHVLAHGAQRALDGEHPFYVVTEFDAADEAAQDAALA
AFEHGVNEGWIADGAIAQSEAQAAALWRLREGITESLAPHKPYKNDISLRIGALPAFLDE
IQALLGDAYPHFEVVWFGHIGDGNLHINVLKPEGLADAEFIAQCEQVTKLLAAALQRHGG
SISAEHGIGLVKKPYLESTRSAAEIALMRGVKQVFDPNGILNPGKLF