Protein Info for ABZR86_RS09540 in Dyella japonica UNC79MFTsu3.2

Annotation: tRNA guanosine(34) transglycosylase Tgt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 TIGR00449: tRNA-guanine family transglycosylase" amino acids 6 to 368 (363 residues), 511.6 bits, see alignment E=1e-157 TIGR00430: tRNA-guanine transglycosylase" amino acids 6 to 368 (363 residues), 539.6 bits, see alignment E=3.5e-166 PF01702: TGT" amino acids 13 to 369 (357 residues), 538.2 bits, see alignment E=4.6e-166

Best Hits

Swiss-Prot: 71% identical to TGT_XANC5: Queuine tRNA-ribosyltransferase (tgt) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 71% identity to xcv:XCV2695)

MetaCyc: 67% identical to tRNA-guanine transglycosylase (Escherichia coli K-12 substr. MG1655)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IAD6 at UniProt or InterPro

Protein Sequence (371 amino acids)

>ABZR86_RS09540 tRNA guanosine(34) transglycosylase Tgt (Dyella japonica UNC79MFTsu3.2)
MTSLRFDISATDGAARRGRLSFDRGTVETPAFMPVGTYGSVKAMTPRDIVEIGAEIILGN
TFHLYLRPGLEIVEQFGGLHRFIGWDKPILTDSGGFQVFSLAHKRKITEEGVTFASPVDG
SKVFLSPEESMRIQKTLDSDVVMIFDECTPYPATEKVAATSMELSLRWAERSRRAFDELH
NPNSLFGIVQGSVYENLRRRSAEGLVGIGFDGYAVGGLAVGEPEAERNHTLDFTVPLLPA
DKPRYLMGVGRPEDIVEAVRRGIDMFDCVMPTRNARNGFLFTAEGTLRIRNAKFAMDTRV
IEEGCDCYACAGGFSRAYLRHLDRCNEILASQLATMHNLRHYQRLMAGLREAIAAGKLEE
FVAEFYARRMD