Protein Info for ABZR86_RS09495 in Dyella japonica UNC79MFTsu3.2

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 38 to 442 (405 residues), 457.3 bits, see alignment E=2.3e-141 PF00909: Ammonium_transp" amino acids 40 to 442 (403 residues), 392.7 bits, see alignment E=8.4e-122

Best Hits

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 69% identity to pfl:PFL_6019)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I7J3 at UniProt or InterPro

Protein Sequence (445 amino acids)

>ABZR86_RS09495 ammonium transporter (Dyella japonica UNC79MFTsu3.2)
MRSKQRRIARLATALLGGLLALPAWSQAAAPTHIDSGDTAWMLTATALVLLMTLPGLALF
YGGMVRAKNLLSVLMQCFAITAVVTVLWIVYGYSLAFSTTGMQAGSTGWHSIIGGLDRAM
LAGLKPDSRYQTVPEAVFVMFQLTFAIITPALIVGAYAERMKFSAMLWFSGLWLTFVYLP
VAHMVWSGPGSLLGDLGVLDFAGGTVVHINAGIAGLIACLVIGKRRGYPHVPMPPHNLGY
TVIGASLLWLGWFGFNAGSAVAANGSAGMAMLVTQIATAAAALGWLVAEWVVHGRPSVLG
IVSGAVAGLVAVTPAAGTAGPGGSLVLGFVAGVVCFFSATRLKHKFGYDDSLDVFGVHAV
AGILGGLLTGPLASPALGGFGTVTSLWGQLWIQAKGVGFTIAWSAVLSFVLLKLIDKTLG
LRVDDEQEMVGLDIALHEEKAYNLS