Protein Info for ABZR86_RS09485 in Dyella japonica UNC79MFTsu3.2

Annotation: SUF system Fe-S cluster assembly regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 TIGR02944: FeS assembly SUF system regulator" amino acids 1 to 130 (130 residues), 167.8 bits, see alignment E=1.5e-53 TIGR00738: Rrf2 family protein" amino acids 4 to 132 (129 residues), 104.6 bits, see alignment E=3.6e-34 PF02082: Rrf2" amino acids 5 to 132 (128 residues), 122.7 bits, see alignment E=1.1e-39 PF09339: HTH_IclR" amino acids 14 to 56 (43 residues), 25.1 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: None (inferred from 61% identity to psu:Psesu_1100)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I7X7 at UniProt or InterPro

Protein Sequence (153 amino acids)

>ABZR86_RS09485 SUF system Fe-S cluster assembly regulator (Dyella japonica UNC79MFTsu3.2)
MLRVSRLTDYATVVMTCIAAHPHDVLSTAQIADEARLELPTVSKLLKSLSHAGLVESFRG
VNGGYRLARPAEAISLAQIVEAMEGPIGMTECGVATGQCERESQCNVRGSWRLVSHVVDN
ALRAVSLADMLKPQPAPPVATVALSTLKSRTTA