Protein Info for ABZR86_RS09465 in Dyella japonica UNC79MFTsu3.2

Annotation: Fe-S cluster assembly protein SufD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 PF19295: SufBD_N" amino acids 27 to 173 (147 residues), 50.5 bits, see alignment E=2.1e-17 TIGR01981: FeS assembly protein SufD" amino acids 152 to 427 (276 residues), 265.8 bits, see alignment E=2.1e-83 PF01458: SUFBD" amino acids 188 to 411 (224 residues), 223.1 bits, see alignment E=3.8e-70

Best Hits

KEGG orthology group: K09015, Fe-S cluster assembly protein SufD (inferred from 49% identity to xal:XALc_1028)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IBT0 at UniProt or InterPro

Protein Sequence (439 amino acids)

>ABZR86_RS09465 Fe-S cluster assembly protein SufD (Dyella japonica UNC79MFTsu3.2)
MSEPARTPFVASLPEAAALARLPGSEIAWLEAARRENLDAVAAAGLPDTRVEAWKYTALR
ALAQRSFAHGDAQAATRAVDAAALVLPGVDGPRLVFVNGAFRADLSALERLPAGLSLRPL
SQALREDAEGLRFALSHRYREAGDAFARLNAALAGDGVVLRVAANTQVAAPVHLLFLGAP
AEGDLAWHLRNIVELEEGAELALVEHHAAAGAQKHLATVVGDVVLRDGAKLDYAIVQDAA
EDATLIRRSQLRLGSRAQATLHVQELGGALVRHDLRAELAGDEARFVSNGVFALHGRQHV
DTQLALRHAALNTASESTWRGVADQRSRGVFRGAIVVAEGADGSDASLSSKNLLLSALAE
VDTKPELEIYADEVKAAHGATVGQLDERALFYLRSRGIPHAEARAMLTAAFCRAVLQAMP
NEALREHVAQLLLAHLPAE