Protein Info for ABZR86_RS09430 in Dyella japonica UNC79MFTsu3.2

Annotation: non-heme iron oxygenase ferredoxin subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 35% identical to NDOA_PSEPU: Naphthalene 1,2-dioxygenase system, ferredoxin component (ndoA) from Pseudomonas putida

KEGG orthology group: K05710, ferredoxin subunit of phenylpropionate dioxygenase (inferred from 58% identity to smt:Smal_0994)

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

1,2,4,5-tetrachlorobenzene degradation (2/2 steps found)
1,2,4-trichlorobenzene degradation (1/2 steps found)
1,2-dichlorobenzene degradation (1/2 steps found)
1,3-dichlorobenzene degradation (1/2 steps found)
3-chlorotoluene degradation I (1/2 steps found)
chlorobenzene degradation (1/2 steps found)
dibenzofuran degradation (1/3 steps found)
biphenyl degradation (2/5 steps found)
3,4-dichlorotoluene degradation (2/6 steps found)
1,4-dichlorobenzene degradation (4/9 steps found)
2,5-dichlorotoluene degradation (2/7 steps found)
naphthalene degradation (aerobic) (1/6 steps found)
2,4-dichlorotoluene degradation (3/9 steps found)
naphthalene degradation to acetyl-CoA (2/12 steps found)
superpathway of aromatic compound degradation via 2-hydroxypentadienoate (8/42 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.12 or 1.14.12.18 or 1.14.12.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I909 at UniProt or InterPro

Protein Sequence (107 amino acids)

>ABZR86_RS09430 non-heme iron oxygenase ferredoxin subunit (Dyella japonica UNC79MFTsu3.2)
MSGWTYVGTRAELLPGEFKVVYDEVTQEPIAIYNIDGDLYAVQDLCTHDGGDLAGGEVHG
FEVECPRHGARFDLRTGEAMCPPAYEPIAKFPVREAHGGIWTRDDRE