Protein Info for ABZR86_RS09415 in Dyella japonica UNC79MFTsu3.2

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF00005: ABC_tran" amino acids 32 to 181 (150 residues), 114.4 bits, see alignment E=9.7e-37

Best Hits

Swiss-Prot: 44% identical to YKNY_BACSU: Uncharacterized ABC transporter ATP-binding protein YknY (yknY) from Bacillus subtilis (strain 168)

KEGG orthology group: K02003, (no description) (inferred from 68% identity to xal:XALc_1772)

MetaCyc: 44% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"ABC transporter, ATP-binding protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I923 at UniProt or InterPro

Protein Sequence (251 amino acids)

>ABZR86_RS09415 ABC transporter ATP-binding protein (Dyella japonica UNC79MFTsu3.2)
MASATPASATISLQARGVAKSFESGRVRSTVLHDLTLDMRSGELTLISGPSGCGKSTLLA
ILSGLQRPDSGQVTALGQDLGQLDIRALERFRLLHTGFVFQGFNLFPALNAVEQVELPLS
YLGLAPREARRRAVASLEEVGLGPRMRLRPSELSGGEKQRVAIARALAKEPELLFADEPT
SALDAANGQTIIDILHRIARAHGTTVLCVSHDPRLVGHADRVLAMEDGRILSDRSQPSLP
DAVPGLKESAS