Protein Info for ABZR86_RS09410 in Dyella japonica UNC79MFTsu3.2

Annotation: FtsX-like permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 17 to 42 (26 residues), see Phobius details amino acids 247 to 272 (26 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 37 to 224 (188 residues), 35.5 bits, see alignment E=1.3e-12 PF02687: FtsX" amino acids 260 to 372 (113 residues), 40.6 bits, see alignment E=2.3e-14

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 59% identity to xal:XALc_1771)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7)" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2IAD0 at UniProt or InterPro

Protein Sequence (377 amino acids)

>ABZR86_RS09410 FtsX-like permease family protein (Dyella japonica UNC79MFTsu3.2)
MVALARKTLVYEWRRFLPAILAVGFAGLLQLLQAALVLGIFGSASVYITGSSADLWAGYP
GTQSVNLGRPIDAGVEMRLRMDPAVSQVEPFHWVDADWRGPNDTGGVSVFVSGIDTRAEG
MLFAHALPVGLRARLNEPDAVIVDRADLGSLGVKVGDKAVINGHRVRVVGVSSGLRALGG
VNVVASLATAAELDTDPANVNRMTYFVAKLRNPAQAEAVAARLRGTTAFGSYDVWTARDF
ARRSQLYWMFDTGAGAGVLFLAGIVFLVGAVITSQTLVAAVIGSVREYATLNALGVGVGA
LRKVVMEQAFWVGAIGLVGSAVLGGIFFAFARSRSVPVALDPLTTAACLLLGMGLAIVSG
LAAMRSLRRADPASLLR