Protein Info for ABZR86_RS09380 in Dyella japonica UNC79MFTsu3.2

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 90.4 bits, see alignment E=8.6e-30 PF00486: Trans_reg_C" amino acids 147 to 218 (72 residues), 69.4 bits, see alignment E=2.3e-23

Best Hits

Swiss-Prot: 43% identical to BASR_SALTY: Transcriptional regulatory protein BasR (basR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 71% identity to sml:Smlt1422)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2I635 at UniProt or InterPro

Protein Sequence (226 amino acids)

>ABZR86_RS09380 response regulator transcription factor (Dyella japonica UNC79MFTsu3.2)
MRILIAEDDPAIAAGVCASLRQSGHAVDHVNDGARADSALRDTPYDLLILDLGLPNLDGS
EVLQRLRKRGAGLPVLVITAREGLRERVRVLDLGADDYLVKPFALAEFEARVRALLRRYT
AQGAPEMSIGRLRLDLPGHRAWVDDAPLELTAREFGLLEALAARPDRVTSRAQLVEALCN
WDEELTDNGLDIAIYRLRRKLSGSGTQVRTIRGLGYLLEESKEGVE