Protein Info for ABZR86_RS09190 in Dyella japonica UNC79MFTsu3.2

Annotation: type IV pilin protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details PF07963: N_methyl" amino acids 10 to 34 (25 residues), 39.9 bits, see alignment 2.1e-14 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 13 to 35 (23 residues), 35.6 bits, see alignment 2.7e-13 PF16732: ComP_DUS" amino acids 36 to 123 (88 residues), 77.6 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: K02655, type IV pilus assembly protein PilE (inferred from 47% identity to eba:ebD88)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2D870 at UniProt or InterPro

Protein Sequence (143 amino acids)

>ABZR86_RS09190 type IV pilin protein (Dyella japonica UNC79MFTsu3.2)
MIKTMRLLDRDARGFTLIELMVVVAIIAILAAFAVPNYLRYGLRARRADGQNVLLRVASA
QERFYSTNNRYGSLSDIGFGSGNTSEKGYYTVAVTPATPGTTFTATATPVAGGPQAKDDC
KALNITNAGAKGSTGTTTNGTCW